PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn276961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 273aa    MW: 30807 Da    PI: 7.4507
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn276961genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.91.4e-21278272128
         NAM  72 krknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 + ++rat+sgyWkatgk+++v+s +++l g+k+tLvf+kgrapkge+t+W+mhey +
  Achn276961  27 RVRKRATESGYWKATGKERNVKS-GSNLLGTKRTLVFHKGRAPKGERTEWIMHEYCM 82 
                 345779*****************.99*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.996198IPR003441NAC domain
PfamPF023651.7E-102781IPR003441NAC domain
SuperFamilySSF1019413.66E-232997IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MVAGQRVSVL ADRRRIDILL LEEEARRVRK RATESGYWKA TGKERNVKSG SNLLGTKRTL  60
VFHKGRAPKG ERTEWIMHEY CMSGMSQDSL VVCRLRKNTE FRLNDSPRQG SSSLRPLSTE  120
DSINFTLSEV AVEQLGLLEG AKAVESCLKE CSSSHNSHSV EQQIDSESES NLKLAIELSQ  180
LCSSSCQGFD DEECYAEILK DDIVDLGKTL LPPTPDLLPM VPEKTEDEKC CQQPEQAIPS  240
HVLPLQGKAN RRIRLRWLKY HHKFHFKPVE NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-13319794167NAC domain-containing protein 19
3swp_C4e-13319794167NAC domain-containing protein 19
3swp_B4e-13319794167NAC domain-containing protein 19
3swp_A4e-13319794167NAC domain-containing protein 19
3swm_D4e-13319794167NAC domain-containing protein 19
3swm_C4e-13319794167NAC domain-containing protein 19
3swm_B4e-13319794167NAC domain-containing protein 19
3swm_A4e-13319794167NAC domain-containing protein 19
4dul_B4e-13319791164NAC domain-containing protein 19
4dul_A4e-13319791164NAC domain-containing protein 19
1ut7_B4e-13319791164NO APICAL MERISTEM PROTEIN
1ut7_A4e-13319791164NO APICAL MERISTEM PROTEIN
1ut4_B4e-13319791164NO APICAL MERISTEM PROTEIN
1ut4_A4e-13319791164NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872645.11e-79PREDICTED: NAC domain-containing protein 40-like
TrEMBLW9RH242e-74W9RH24_9R
STRINGVIT_06s0080g00970.t019e-73(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.11e-41NAC domain containing protein 60